Share
Explore BrainMass

DNA, Chromosomes and the Genomes

DNA, chromosomes and the genome are three inter-related terms which represent the genetic composition of organisms. It is within the nucleus of a cell that the genome is housed and it includes both chromosomes and DNA.

The best way to differentiate these three interlinked terms is to start from the “smallest” term and move upwards. Thus, DNA is the most basic level within the genetic tree of terminology.

DNA is made up of nucleosides which are connected to each other with hydrogen bonds and are esterified to phosphate groups. These nucleosides contain a nitrogenous base and a deoxyribose sugar. There are four possible nitrogenous bases: adenine, guanine, thymine and cytosine. Adenine and guanine are most similar in structure and are called purines, whereas thymine and cytosine are pyrimidines.

Furthermore, each DNA molecule is made up of two anti-parallel strands. Each individual strand is built of connected nucleosides and the two strands are linked by hydrogen bonds which connect the nitrogenous bases together.  Adenine and thymine bases are paired together and held by two hydrogen bonds, whereas cytosine is paired with guanine and requires three hydrogen bonds. Once bonded together, the DNA strands create a helical structure, see Figure 1.

Figure 1. This figure represents a strand of DNA. This image has been taken from http://commons.wikimedia.org/wiki/File:Difference_DNA_RNA-EN.svg and been modified.

After DNA, the next level up is the chromosome, which is composed of long stretches of DNA which are condensed very tightly together. Chromosomes are continually condensed by the influence of associated proteins. Basically, DNA is divided into chromosomes, although this number varies per organism. For example, humans have 23 pairs of chromosomes, whereas a donkey has 62.

The genome is the largest genetic unit. The genome is found within the nucleus of a cell and it is made up of the entire collection of chromosomes. Genomes are present in prokaryotic cells, eukaryotic cells and some organelles. However, the complexity of the genome varies. Evidently, DNA, chromosomes and the genome are three inextricably linked terms.

 

 

Categories within DNA, Chromosomes and the Genomes

RNA and Proteins

Postings: 56

RNA and proteins are two biological molecules which are dependent upon each other and play a role in controlling the functions of an organism.

Rosalind Franklin's Contribution to DNA Structure

What is the controversy around the history of the discovery of the structure of DNA? Who do you think should receive credit? How does giving credit only to Watson and Crick reflect on the Scientific Method in general? Please provide references as well.

Type II and Type I Restriction Endonucleases

Please help me answer these questions about restriction enzymes. What is a restriction endonuclease? Why do molecular biologists use restriction enzymes? What is the difference between type I and type II restriction endonucleases and why are type II restriction endonucleases more useful for molecular biologists than type I r

Imprinting and replication

Instructions: In your own words, define the pairs of terms given below. Write in complete sentences, stating the differences and relationships between the two terms, and give specific examples where appropriate. A complete answer usually requires four to eight sentences. Each question is worth four marks, for a total of 40 mar

DNA Synthesis and RNA Transcription

1. Compare and contrast DNA synthesis in prokaryotes and eukaryotes. 2. What are the three main types of RNA, and what are their roles? 3. Using the following DNA template strand sequence, answer the questions below: 3'-TACCGGCACGATTAG-5' a. What is the mRNA sequence? b. List the anticodons for each tRNA involved in transla

Taxonomy Lab to Show Organism Relationships

Part 1: Using the lab animation, fill in the following data tables to help you answer the questions that follow: Table 1: Samples 1-5 Phylum/Division Sample 1: Chrysophyta Sample 2: Annelida Sample 3: Arthropoda Sample 4: Amphibia Sample 5: Aves Common Feature Nutrition How does the organism break down and absorb f

Chromosomes breaks

Illustrate, define and describe single break chromosomes: - One arm of one chromosome - One arm of two chromosomes Illustrate, define and describe double break chromosomes: - One arm of one chromosome - Both arms of one chromosome

DNA Sequence Variation, Epigenetics, and Gel Electrophoresis

Question 1: Describe DNA sequence variations that can be often observed among individuals of the same species. Discuss the possible phenotypic consequences of these DNA sequence variation, give examples, if possible. Discuss the technologies or methods that are often used in detect each of these variations. Question 2: Descri

Biology - Prokaryotes & Eukaryotes Biodiversity, Evolution, Fossils

Briefly review how prokaryotes and eukaryotes provide different forms of biodiversity and why. What does each category tell you about evolution; pick one from an early era and one from today or recent times: Review two species of the seas Review two species on land and water Review two species on land Review two s

mRNA and Microarray Experiments

Please help with the following problem. You perform three microarray experiments in which you measure the mRNA levels in Rb mutant cell line (RB triangle) and in a control cell line (wild-type). The background subtracted. Normalized microarray data for three genes are given below. Please see the attached MS Word document

DNA Synthesis

Write an equation that describes the synthesis of DNA. A chemical equation that describes the synthesis of DNA can be: (DNA)n + dNTPs + DNAPol <--------> (DNA)n+1 + PPi (2) DNAPol = DNA polymerase (DNA)n = template DNA (DNA)n+1 = growing new DNA strand PPi = two pyrophosphate released

Southern Blot Technique

Which of the below describes the correct order in which procedures are carried out when using the Southern Blot technique? (a) Cutting the DNA with restriction enzyme, blotting the DNA, electrophoresis of DNA, hybridizing the DNA with probe. (b) Cutting DNA with restriction enzyme, electrophoresis of DNA, blotting the DNA, hy

Replication and Transcription

The following table contains a list of statements that apply to replication, transcription, both, or neither. In each empty box, put a check mark (√) if that Statement applies to replication or transcription. Replication

Biology: DNA Code and Sequence Alignments

1. You clone a double stranded DNA fragment from a pathogenic fungal stain. You suspect that the fragment contains a gene encoding a Seven Amino Acid Peptide. Here's one of the DNA strand fragments: 5' T G A G A T G C T T A G C T G C A A A C C T A T T T A A A C 3' A) What's the amino acid sequence of this peptide? B)

Genetic Screening and Prevention Case Study

Genetic Screening and Prevention: A Case Study Mary Jane Smith is a 30 year old mother of two young boys who has recently lost both her mother and an older sister to breast cancer. After learning about the development of a test for determining one's susceptibility to a particular form of breast cancer, Mary decides to have th

Determining genotypes

A pregnant woman is worried about the chances of her child having hemophilia as both she and her husband have paternal grandfathers with hemophilia. Neither their parents nor their maternal grandparents have hemophilia. What is the genotype of the paternal grandfathers who have hemophilia? What is the genotype of their g

DNA Testing to Settle Disputes

Describe the structure of DNA and explain how it allows DNA to be used in solving crimes, paternity testing, identifying tendencies for diseases, treating or curing genetic diseases, stem cell research, curing viral diseases, curing cancer, replacing body parts, changing human characteristics.

G-Protein Linked Receptors

G-protein linked receptors activate G proteins by reducing the strength of GDP binding. This results in rapid dissociation of bound GDP, which is then replaced by GTP, which is present in the cytosol in much higher concentrations than GDP. What consequences would result from a mutation in the alpha subunit of the G protein that

Consensus Sequence in DNA

Attached is a file I need to use to answer some questions. The DNA is 5' to 3' These questions refer to an intron that starts at nucleotide 128 and is 179 nucleotides long, ending at nucleotide 306. 1. By how many nucleotides do the first six nucleotides (on the 5' end) of the first intron differ from their consensus seque

Genotyping and Phenotyping Traits

1. Would the person who could roll his/her tongue know their genotype for certain? Why? 2. What might determine whether a person who shows the dominate characteristic is homozygous dominant or heterozygous? 3. Now, knowing the details of red-green deficiency, please explain why males tend to show sex-linked traits more than fe

Analyze chromosomal inversions or deletion with human disorders

1. What are some examples of chromosome deletions that have been documented in humans? 2. Name a human congenital disorder that has been attributed to a chromosomal deletion. How common is the disorder? Which human chromosome has suffered a deletion in the disorder? 3. Find an example of a chromosomal inversion that has be

Epignetics and Complex Gene Regulation.

Epigenetics and complex gene regulation have fundamentally altered the way we deal with bioinformatics and biotechnology. Come to the exam prepared to discuss how the following topics related to or affected by this newfound knowledge: (a) linking phenotype to genotype (b) the use of cancer cell lines and stem cell lines in r

RFLPs, VNTR, SNP - Definitions and Uses

What are restriction fragment length polymorphisms (RFLPs), variable number tandem repeat (VNTRs), and single nucleotide polymorphisms (SNPs)? What is the relationship among these? How do we use this technology to, for example, identify paternity?

Edward Chace Tolman (1886-1959) and Albert Bandura (1925-present) are assessed.

1) Edward Chace Tolman was an American psychologist who made significant contributions to the study of learning and motivation. How can this information be applied to schools and vocational training? 2) Albert Bandura is an expert on observational learning. What are the implications for raising children considering Bandura's

E.coli

An Escherichia coli plasmid in a closed circle with 5, 200 bp and naturally has 26 negative super coil turns. 1.Calculate the linking number for this plasmid. Assume it is adopting 10.4 bps/turn of the regular B-DNA. 2.The above super coiled plasmid has been linearized by treating with a dsDNA breaking enzyme. What's the len

Use of BLAST Online Database to Search for Protein Identity

Q.2 Supplied below is a query amino acid sequence. Perform a BLAST Search Query Amino Acid Sequence. MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSâ?¦ Perform a search to

Gender determination

1. How is sex determined in grasshoppers? Can you find other examples of organisms with a similar system of sex determination? 2. Some marine shellfish, such as limpets, become either male or female depending on where they grow. What makes one limpet a male and another a female? 3. Are there other organisms whose sex is determ

Compare and contrast

Please pick one of the following to compare/contrast: 1. germ line engineering/gene therapy 2. transcription/translation 3. DNA/RNA 4. codon/anticodon 5. exon/intron 6. leading strand/lagging strand